PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0012s0460.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family Dof
Protein Properties Length: 326aa    MW: 35696.2 Da    PI: 9.5107
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0012s0460.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1183.6e-373490561
                  zf-Dof  5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                             +kcprC+s ntkfCyynnyslsqPryfCk+CrryWt GG++rnvPvGgg+rk k+ 
  SapurV1A.0012s0460.1.p 34 PQKCPRCESLNTKFCYYNNYSLSQPRYFCKTCRRYWTLGGTMRNVPVGGGCRKGKRP 90
                            689**************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.1E-313589IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.3323589IPR003851Zinc finger, Dof-type
ProDomPD0074782.0E-233689IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103773IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MQRKMQGGSE DVKPNQERRL KSTQGDNQQP QPPPQKCPRC ESLNTKFCYY NNYSLSQPRY  60
FCKTCRRYWT LGGTMRNVPV GGGCRKGKRP KTSSSSSSGE NSLLQQQPQL LQHNLATPQN  120
ILATTNSGNS LSPPMRTKES GNLVSPPPGM SSMGSYFPGD GFLTSLEAIQ SLKNSQPPLQ  180
SFSFQPLNQP VNLGGDLGDT SNLGLLHGFS AVPAFGSQNQ QQRQFYHADN RDNKSVEHSF  240
YPQYDQERLI QSSRPAATSS HQQQNWHQGY ISNSNPTVSD TVLWSISTST TTGHTSSNIN  300
TGNGGSSSLN PDQWRHDLPG NGPPS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002305784.10.0hypothetical protein POPTR_0004s04590g
TrEMBLB9H2S70.0B9H2S7_POPTR; Uncharacterized protein
STRINGPOPTR_0004s04590.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41453258
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.15e-32OBF binding protein 4